Immunomodulatory peptide is one of those subjects where the details matter more than the headlines. This page pulls together the background, the mechanisms, and the practical points readers ask about most.
Updated 2026-07-27. Numbers and descriptions here follow the published literature rather than marketing material.
Thymosin alpha 1 is approved as a medicine in several countries, including Italy and China, for indications such as chronic hepatitis B and as an immune adjuvant. It is not approved by the United States Food and Drug Administration as a therapeutic product. In research settings the peptide appears in studies of sepsis, vaccine response, and oncology support, often with mixed or inconclusive results. The evidence base is uneven, and reviews note that many trials were small. Regulatory status therefore differs widely between jurisdictions.
Thymosin alpha 1 is a synthetic 28-amino-acid peptide first isolated in 1966 from thymosin fraction 5, a bovine thymus extract. Its chain begins with an acetylated serine residue and ends with asparagine. The native peptide carries a molecular mass near 3,108 daltons. Researchers classify it as an immunomodulatory agent rather than a hormone with a single endocrine target. Early work framed it as a thymus-derived factor that supports T-cell maturation. The synthetic form used in research and clinical products matches the natural sequence.
Biologically, the peptide is studied mainly in the context of immune cell development and regulation. It is produced in the thymus and in several other tissues, and it appears to influence the maturation and activity of T cells and other immune populations. Laboratory work describes effects on cytokine production, on the balance between T cell subsets, and on the function of dendritic cells. Much of this evidence comes from cell culture and animal models, so the extent to which the same pathways operate in humans remains an open question.
Clinical interest has centered on chronic viral hepatitis, on immune restoration in various conditions, and on use as an adjuvant intended to improve responses to vaccines. Trials have reported mixed results, and regulatory status differs sharply between countries; in some places it is a prescription product, while elsewhere it is sold without an approved therapeutic indication. Because published studies vary widely in design, population, and endpoints, comparisons across them are difficult and no single conclusion covers the whole literature.
Thymosin alpha 1 is a short peptide of 28 amino acid residues that derives from the amino terminal region of a larger precursor protein known as prothymosin alpha. The peptide carries an acetyl group on its first residue and contains no disulfide bonds or carbohydrate chains. Its sequence is highly conserved across mammalian species, which is one reason laboratories treat it as a molecule with a defined and reproducible structure rather than a variable tissue extract. The name follows an early naming convention for thymus-derived fractions and does not imply that the peptide acts as a hormone in the classical endocrine sense.
| Property | Value | Notes |
|---|---|---|
| Molecular mass | ≈3,108 Da | Synthetic 28-residue peptide |
| Amino acid count | 28 | N-terminal serine carries an acetyl group |
| Appearance | White to off-white powder | Lyophilized solid |
| Water solubility | Freely soluble | Dissolves in aqueous buffer |
| Common synonyms | Thymalfasin; Tα1 | Thymalfasin is the international nonproprietary name |
Clinical research has examined the peptide in chronic hepatitis B and C, as a vaccine adjuvant, and in sepsis and oncology settings. Results across trials have been mixed, and several studies were small or conducted under differing protocols. Regulatory status varies by country, and the compound is not approved in every jurisdiction where it is studied. Evidence for any single indication should be read with attention to sample size and endpoint choice.
Thymosin alpha-1 is a 28-residue peptide first isolated from thymus tissue in the 1970s. It corresponds to the N-terminal portion of thymosin beta-4, from which it is cleaved in vivo. The peptide carries an acetyl group at its N-terminus, a modification that affects its charge and stability. Synthetic material produced by solid-phase peptide synthesis is chemically identical to the natural fragment and is the form used in research and clinical studies.
Identity and purity are usually assessed by reversed-phase high-performance liquid chromatography, which separates the target peptide from truncated or chemically modified byproducts. Mass spectrometry confirms the expected molecular mass and can indicate acetylation state or sequence errors. Amino acid analysis and peptide mapping supply complementary sequence-level information, while endotoxin testing is relevant for preparations intended for cell or animal work. Purity figures reported by suppliers refer to the method used and are not directly comparable across laboratories unless conditions are stated.
Lyophilized material is typically treated as a hygroscopic solid that should be brought to room temperature before the container is opened, which limits condensation on the powder. Reconstitution is commonly done with sterile water or a buffered diluent, and gentle mixing is preferred over vigorous agitation to reduce foaming and surface adsorption. Because peptides can bind to plastic and glass, diluents containing a small amount of carrier protein are sometimes used in laboratory work. Working solutions are generally aliquoted and prepared fresh rather than subjected to repeated freezing and thawing.
The peptide was identified during work in the 1970s on thymosin fraction 5, a partially purified extract of calf thymus. Investigators separated that mixture and characterized individual components, one of which they named thymosin alpha-1. The same compound later received the international nonproprietary name thymalfasin. Commercial material is produced by solid-phase peptide synthesis rather than by extraction, so synthetic and natural forms share an identical sequence. Naming conventions vary across the literature, and readers should distinguish the alpha-1 peptide from other thymosins that have unrelated sequences and functions.
Thymosin beta-4 is a separate 43-residue peptide that binds actin and participates in cell migration; it shares no sequence similarity with thymosin alpha-1 despite the common family name. Other preparative materials, such as thymosin fraction 5 and thymopoietin, contain distinct mixtures or peptides. The shared thymosin label reflects the tissue of origin used in early purification, not a common structural core. Treating these molecules as interchangeable is a frequent source of confusion in laboratory reports and in popular summaries alike.
Thymosin alpha-1 is a synthetic peptide of 28 amino acid residues that corresponds to a naturally occurring fragment first isolated from thymus tissue. Its chain is acetylated at the amino terminus, a modification that shields the peptide from rapid cleavage by aminopeptidases. The molecule carries a net negative charge at physiological pH and dissolves freely in water. Researchers classify it as an immune-modulating agent rather than a classical hormone, because it acts on several cell types of both the innate and the adaptive immune system.
=== Phosphorylation === Stimuli such as hormones, growth factors, and mitogens that promote cell proliferation also enhance translation rates by phosphorylating eIF4E. Although eIF4E phosphorylation and translation rates are not always correlated, consistent patterns of eIF4E phosphorylation are observed throughout the cell cycle; wherein low phosphorylation is seen during G0 and M phase and wherein high phosphorylation is seen during G1 and S phase. This evidence is further supported by the crystal structure of eIF4E which suggests that phosphorylation on serine residue 209 may increase the affinity of eIF4E for capped mRNA. eIF4E phosphorylation is also related to its ability to suppress RNA export and its oncogenic potential as first shown in cell lines.
Kalra graduated from Christian Medical College, Ludhiana. He completed his postgraduation (MD) in Medicine at Pandit Bhagwat Dayal Sharma Post Graduate Institute of Medical Sciences, Rohtak, and his fellowship (DM) in Endocrinology and Metabolism at the All India Institute of Medical Sciences, New Delhi.
Silver nanoparticles (AgNPs) act primarily through a process known as oxidative dissolution, wherein Ag+ ions are released through an oxidative mechanism. AgNPs have potentially vast applications within the fields of medicine, science, and food and drug industries due to their antimicrobial properties, low cytotoxicity in humans, and inexpensive cost.
=== Diabetes === The diabetes management manufacturing and sales division of Medtronic is based on the perimeter of the California State University, Northridge campus in Northridge, California. The original company, Minimed Technologies, was founded in 1983 by Alfred E. Mann and spun off from Pacesetter Systems to design and market an open loop insulin pump. The MiniMed 502 was one of the first lightweight insulin pumps on the market, and it helped bring insulin pump usage to the mainstream market. In 1992, the MiniMed 506 was a major redesign to make it more appealing to consumers. The new design was met by boosted adoption rate, and sales increased by 357%. In 2001, Medtronic purchased Minimed, to form Medtronic Minimed. On 11 May 2009, Medtronic announced it had chosen San Antonio, Texas, for the location of its new Diabetes Therapy Management and Education Center. The company announced that it expected 1400 new jobs would be created to staff the 150,000-square-foot (14,000 m2) facility. In September 2016, the FDA approved a device, the MiniMed 670G which was launched in 2017. It was the world's first Hybrid Closed Loop system for people with type 1 diabetes. Featuring the company's advanced algorithm - SmartGuard technology and glucose sensor - Guardian™ Sensor 3, it was the first insulin pump approved by the Food and Drug Administration (FDA) that enabled personalized and automated* delivery of basal insulin, the background insulin needed to maintain stable blood sugar levels throughout the day and night.
Sources: en.wikipedia.org
Lepirudin is an anticoagulant that functions as a direct thrombin inhibitor. Brand name: Refludan, Generic: Lepirudin rDNA for injection. Lepirudin is a recombinant hirudin derived from yeast cells. Lepirudin is almost identical to hirudin extracted from Hirudo medicinalis, having the amino acid sequence LTYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ with disulfide bridges at Cys6-Cys14, Cys16-Cys28 and Cys22-Cys39, and differs from by the substitution of leucine for isoleucine at the N-terminal end of the molecule and the absence of a sulfate group on the tyrosine at position 63. Lepirudin may be used as an anticoagulant when heparins (unfractionated or low-molecular-weight) are contraindicated because of heparin-induced thrombocytopenia.
isochromosome A type of abnormal chromosome in which the arms of the chromosome are mirror images of each other. Isochromosome formation is equivalent to simultaneous duplication and deletion events such that two copies of either the long arm or the short arm comprise the resulting chromosome.
ATP + H2O → ADP + Pi ΔG°' = −30.5 kJ/mol (−7.3 kcal/mol) ATP + H2O → AMP + PPi ΔG°' = −45.6 kJ/mol (−10.9 kcal/mol) These abbreviated equations at a pH near 7 can be written more explicitly (R = adenosyl):
On 31 October 1899, General Sir Redvers Henry Buller, a much-respected commander, arrived in South Africa with the Army Corps, made up of the 1st, 2nd and 3rd divisions. Buller originally intended an offensive straight up the railway leading from Cape Town through Bloemfontein to Pretoria. Finding on arrival that British troops were under siege, he split his army corps into detachments to relieve the besieged garrisons. One division, led by Lieutenant General Lord Methuen, was to follow the Western Railway to the north and relieve Kimberley and Mafeking. A smaller force of 3,000, led by Major General William Gatacre, was to push north towards the railway junction at Stormberg and secure the Cape Midlands District from Boer raids and rebellions by Boer inhabitants. Buller led the major part of the army corps to relieve Ladysmith to the east. The initial results of this offensive were mixed, with Methuen winning bloody skirmishes in the Battle of Belmont on 23 November, the Battle of Graspan on 25 November, and at a larger engagement, the Battle of Modder River, on 28 November resulting in British losses of 71 dead and over 400 wounded. British commanders had been trained on the lessons of the Crimean War and were adept at battalion and regimental set pieces, with columns manoeuvring in jungles, deserts and mountainous regions. What British generals failed to comprehend was the impact of destructive fire from trench positions and the mobility of cavalry raids.
== Applications == LbL has found applications in protein purification, corrosion control, (photo)electrocatalysis, biomedical applications, ultrastrong materials, and many more. LbL composites from graphene oxide harbingered the appearance of numerous graphene and graphene oxide composites later on. The first use of reduced graphene oxide composites for lithium batteries was also demonstrated with LbL multilayers.
Sources: en.wikipedia.org
It is a chain of 28 amino acids, with an acetyl group attached to the first serine residue. The synthetic version replicates this sequence. Its molecular mass is about 3,108 daltons.
It is usually described as an immunomodulatory peptide rather than a classic hormone. It acts on immune cells through receptor pathways. No single endocrine organ target defines its function.
Several countries, including Italy and China, allow it for specific indications. The FDA has not approved it as a drug in the United States. Availability depends on local regulation.
The name reflects an early convention for naming thymus-derived fractions. The peptide is characterized and measured as a defined molecule, and it does not operate through a single classical endocrine axis.